SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ezya1 (5ezy A:1-245)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107739Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2107740Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2107741Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2107851Protein automated matches [226837] (6 species)
    not a true protein
  7. 2107920Species Pig (Sus scrofa) [TaxId:9823] [278808] (6 PDB entries)
  8. 2284690Domain d5ezya1: 5ezy A:1-245 [327991]
    Other proteins in same PDB: d5ezya2, d5ezyb2, d5ezyc2, d5ezyd2, d5ezye_, d5ezyf1, d5ezyf2, d5ezyf3
    automated match to d4ihja1
    complexed with acp, ca, gdp, gtp, mes, mg, taj

Details for d5ezya1

PDB Entry: 5ezy (more details), 2.05 Å

PDB Description: crystal structure of t2r-ttl-taccalonolide aj complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5ezya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ezya1 c.32.1.1 (A:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d5ezya1:

Click to download the PDB-style file with coordinates for d5ezya1.
(The format of our PDB-style files is described here.)

Timeline for d5ezya1:

  • d5ezya1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12