Lineage for d1bq7a2 (1bq7 A:2-64,A:129-187)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 315307Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 315308Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 315439Family c.47.1.4: Disulphide-bond formation facilitator (DSBA) [52858] (1 protein)
  6. 315440Protein Disulphide-bond formation facilitator (DSBA) [52859] (2 species)
    common fold is interrupted by a small all-alpha domain
  7. 315441Species Escherichia coli [TaxId:562] [52860] (12 PDB entries)
  8. 315455Domain d1bq7a2: 1bq7 A:2-64,A:129-187 [32798]
    Other proteins in same PDB: d1bq7a1, d1bq7b1, d1bq7c1, d1bq7d1, d1bq7e1, d1bq7f1

Details for d1bq7a2

PDB Entry: 1bq7 (more details), 2.8 Å

PDB Description: dsba mutant p151a, role of the cis-proline in the active site of dsba

SCOP Domain Sequences for d1bq7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bq7a2 c.47.1.4 (A:2-64,A:129-187) Disulphide-bond formation facilitator (DSBA) {Escherichia coli}
qyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyhv
nfmXfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyadtvky
lse

SCOP Domain Coordinates for d1bq7a2:

Click to download the PDB-style file with coordinates for d1bq7a2.
(The format of our PDB-style files is described here.)

Timeline for d1bq7a2: