Lineage for d5hdga1 (5hdg A:15-117)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982720Family a.4.5.22: Heat-shock transcription factor [46873] (2 protein domains)
    automatically mapped to Pfam PF00447
  6. 1982740Protein automated matches [254598] (1 species)
    not a true protein
  7. 1982741Species Human (Homo sapiens) [TaxId:9606] [255429] (3 PDB entries)
  8. 2284670Domain d5hdga1: 5hdg A:15-117 [327971]
    Other proteins in same PDB: d5hdga2
    automated match to d1hksa_
    complexed with na

Details for d5hdga1

PDB Entry: 5hdg (more details), 1.7 Å

PDB Description: crystal structure of heat shock factor 1-dbd
PDB Compounds: (A:) Heat shock factor protein 1

SCOPe Domain Sequences for d5hdga1:

Sequence, based on SEQRES records: (download)

>d5hdga1 a.4.5.22 (A:15-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasfvrqln
mygfrkvvhieqgglvkperddtefqhpcflrgqeqllenikr

Sequence, based on observed residues (ATOM records): (download)

>d5hdga1 a.4.5.22 (A:15-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasfvrqln
mygfrkvvhiedtefqhpcflrgqeqllenikr

SCOPe Domain Coordinates for d5hdga1:

Click to download the PDB-style file with coordinates for d5hdga1.
(The format of our PDB-style files is described here.)

Timeline for d5hdga1:

  • d5hdga1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5hdga2