Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries) |
Domain d5ezyd2: 5ezy D:246-441 [327970] Other proteins in same PDB: d5ezya1, d5ezyb1, d5ezyc1, d5ezyd1, d5ezye_, d5ezyf1, d5ezyf2, d5ezyf3 automated match to d3rycd2 complexed with acp, ca, gdp, gtp, mes, mg, taj |
PDB Entry: 5ezy (more details), 2.05 Å
SCOPe Domain Sequences for d5ezyd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ezyd2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqdatad
Timeline for d5ezyd2: