SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ezyd2 (5ezy D:246-441)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180205Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2180489Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2180490Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 protein domains)
  6. 2180597Protein automated matches [227071] (5 species)
    not a true protein
  7. 2180601Species Cow (Bos taurus) [TaxId:9913] [226565] (33 PDB entries)
  8. 2284669Domain d5ezyd2: 5ezy D:246-441 [327970]
    Other proteins in same PDB: d5ezya1, d5ezyb1, d5ezyc1, d5ezyd1, d5ezye_, d5ezyf1, d5ezyf2, d5ezyf3
    automated match to d3rycd2
    complexed with acp, ca, gdp, gtp, mes, mg, taj

Details for d5ezyd2

PDB Entry: 5ezy (more details), 2.05 Å

PDB Description: crystal structure of t2r-ttl-taccalonolide aj complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5ezyd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ezyd2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

SCOPe Domain Coordinates for d5ezyd2:

Click to download the PDB-style file with coordinates for d5ezyd2.
(The format of our PDB-style files is described here.)

Timeline for d5ezyd2:

  • d5ezyd2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12