Lineage for d5ezyd1 (5ezy D:1-245)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107739Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2107740Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2107741Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2107851Protein automated matches [226837] (7 species)
    not a true protein
  7. 2107855Species Cow (Bos taurus) [TaxId:9913] [226564] (43 PDB entries)
  8. 2284668Domain d5ezyd1: 5ezy D:1-245 [327969]
    Other proteins in same PDB: d5ezya2, d5ezyb2, d5ezyc2, d5ezyd2, d5ezye_, d5ezyf1, d5ezyf2, d5ezyf3
    automated match to d4drxb1
    complexed with acp, ca, gdp, gtp, mes, mg, taj

Details for d5ezyd1

PDB Entry: 5ezy (more details), 2.05 Å

PDB Description: crystal structure of t2r-ttl-taccalonolide aj complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5ezyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ezyd1 c.32.1.1 (D:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d5ezyd1:

Click to download the PDB-style file with coordinates for d5ezyd1.
(The format of our PDB-style files is described here.)

Timeline for d5ezyd1:

  • d5ezyd1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12