SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h35b2 (5h35 B:113-217)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (13 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (462 PDB entries)
  8. 2284667Domain d5h35b2: 5h35 B:113-217 [327968]
    Other proteins in same PDB: d5h35b1, d5h35g1, d5h35i1
    automated match to d1t66c2
    complexed with gol, na, px4

Details for d5h35b2

PDB Entry: 5h35 (more details), 2.64 Å

PDB Description: crystal structures of the tric trimeric intracellular cation channel orthologue from sulfolobus solfataricus
PDB Compounds: (B:) Fab light chain

SCOPe Domain Sequences for d5h35b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h35b2 b.1.1.2 (B:113-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d5h35b2:

Click to download the PDB-style file with coordinates for d5h35b2.
(The format of our PDB-style files is described here.)

Timeline for d5h35b2:

  • d5h35b2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12