Lineage for d5h3ha_ (5h3h A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (89 species)
    not a true protein
  7. 2284620Species Exiguobacterium antarcticum [TaxId:1087448] [327921] (1 PDB entry)
  8. 2284665Domain d5h3ha_: 5h3h A: [327966]
    automated match to d1zoia_
    complexed with f50

Details for d5h3ha_

PDB Entry: 5h3h (more details), 1.9 Å

PDB Description: esterase (eaest) from exiguobacterium antarcticum
PDB Compounds: (A:) Abhydrolase domain-containing protein

SCOPe Domain Sequences for d5h3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h3ha_ c.69.1.0 (A:) automated matches {Exiguobacterium antarcticum [TaxId: 1087448]}
mgtfiqavdgtkiyvedigsgqpvvmlhgwpannnmfeyqknrlleegyryigvdyrgyg
ksdapatgydyttmasdineviqqlkltnvtllgfsmgggialkyllnhgesnvsklila
gaaapvftqrdgypygmtkdevdaliedtkqdrpsmlkgfgeiffakehpeplqqwfhnl
svdasshgtiqsaialrdedlrdglpkitvdtlimhgkkdqvcpfefaevmheniagsrl
evfeesghgmflderekftetlvsyvks

SCOPe Domain Coordinates for d5h3ha_:

Click to download the PDB-style file with coordinates for d5h3ha_.
(The format of our PDB-style files is described here.)

Timeline for d5h3ha_:

  • d5h3ha_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12