SCOPe 2.06: Domain d5fvga_: 5fvg A:

Lineage for d5fvga_ (5fvg A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (21 species)
   not a true protein

7. Species Lobophyllia hemprichii [TaxId:46758] [187486] (21 PDB entries)

8. Domain d5fvga_: 5fvg A: [327962]
   Other proteins in same PDB: d5fvgb2, d5fvgc2
   automated match to d2vvjc_
   complexed with so4

Details for d5fvga_

PDB Entry: 5fvg, 1.9 Å

PDB Description: structure of irisfp at 100 k.

PDB Compounds: (A:) Green to red photoconvertible GFP-like protein EosFP

SCOPe Domain Sequences for d5fvga_:

Sequence; same for both SEQRES and ATOM records:

>d5fvga_ d.22.1.0 (A:) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn

Timeline for d5fvga_:

• d5fvga_ is new in SCOPe 2.06-stable
  
• d5fvga_ appears in SCOPe 2.07
  
• d5fvga_ appears in the current release, SCOPe 2.08