SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hdya1 (5hdy A:302-402)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048294Family b.36.1.1: PDZ domain [50157] (47 protein domains)
    Pfam PF00595
  6. 2048519Protein Synaptic protein PSD-95 [50162] (2 species)
    Synonym: synapse associated protein 90, sap90
    duplication: contains three PDZ domains
  7. 2048522Species Norway rat (Rattus norvegicus) [TaxId:10116] [50163] (12 PDB entries)
    Uniprot P31016 62-154
  8. 2284649Domain d5hdya1: 5hdy A:302-402 [327950]
    Other proteins in same PDB: d5hdya2, d5hdya3
    automated match to d1be9a_
    complexed with gol

Details for d5hdya1

PDB Entry: 5hdy (more details), 1.8 Å

PDB Description: the third pdz domain from the synaptic protein psd-95
PDB Compounds: (A:) Disks large homolog 4

SCOPe Domain Sequences for d5hdya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hdya1 b.36.1.1 (A:302-402) Synaptic protein PSD-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqils
vngvdlrnasheqaaialknagqtvtiiaqykpeeysrfea

SCOPe Domain Coordinates for d5hdya1:

Click to download the PDB-style file with coordinates for d5hdya1.
(The format of our PDB-style files is described here.)

Timeline for d5hdya1:

  • d5hdya1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12