Lineage for d1fvjb2 (1fvj B:1-64,B:129-188)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 244778Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 244779Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 244889Family c.47.1.4: Disulphide-bond formation facilitator (DSBA) [52858] (1 protein)
  6. 244890Protein Disulphide-bond formation facilitator (DSBA) [52859] (2 species)
    common fold is interrupted by a small all-alpha domain
  7. 244891Species Escherichia coli [TaxId:562] [52860] (12 PDB entries)
  8. 244900Domain d1fvjb2: 1fvj B:1-64,B:129-188 [32795]
    Other proteins in same PDB: d1fvja1, d1fvjb1
    mutant

Details for d1fvjb2

PDB Entry: 1fvj (more details), 2.06 Å

PDB Description: the 2.06 angstrom structure of the h32y mutant of the disulfide bond formation protein (dsba)

SCOP Domain Sequences for d1fvjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvjb2 c.47.1.4 (B:1-64,B:129-188) Disulphide-bond formation facilitator (DSBA) {Escherichia coli}
aqyedgkqyttlekpvagapqvleffsffcpycyqfeevlhisdnvkkklpegvkmtkyh
vnfmXfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyadtvk
ylsek

SCOP Domain Coordinates for d1fvjb2:

Click to download the PDB-style file with coordinates for d1fvjb2.
(The format of our PDB-style files is described here.)

Timeline for d1fvjb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fvjb1