SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kvca1 (5kvc A:3-254)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (226 species)
    not a true protein
  7. 2284646Species Rhizobium radiobacter [TaxId:358] [327947] (1 PDB entry)
  8. 2284647Domain d5kvca1: 5kvc A:3-254 [327948]
    Other proteins in same PDB: d5kvca2, d5kvcb2
    automated match to d3zn2a_
    complexed with cl, edo, imd, na; mutant

Details for d5kvca1

PDB Entry: 5kvc (more details), 1.5 Å

PDB Description: thermostable mutant of halohydrin dehalogenase (hhec)
PDB Compounds: (A:) halohydrin dehalogenase

SCOPe Domain Sequences for d5kvca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kvca1 c.2.1.0 (A:3-254) automated matches {Rhizobium radiobacter [TaxId: 358]}
taivtnvkhfggmgsalrlseaghtvlchdesfkqkkeleafaetypqlkpmseqepael
iravtraygqvdvlvsndifapefrpidkytvedyrgavealqirpfalvnavasqmkkr
ksghiifitsatpfgpwkelstytsaragantlanvlskelgeynipvfaigpnylhsed
spyfypttpwktnpkhiahvkkvtalqrlgtqkelgelvaflasgscdyltgqifwlagg
fpmierwpgmpe

SCOPe Domain Coordinates for d5kvca1:

Click to download the PDB-style file with coordinates for d5kvca1.
(The format of our PDB-style files is described here.)

Timeline for d5kvca1:

  • d5kvca1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5kvca2