Lineage for d5kvca1 (5kvc A:3-254)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (233 species)
    not a true protein
  7. 2284646Species Rhizobium radiobacter [TaxId:358] [327947] (1 PDB entry)
  8. 2284647Domain d5kvca1: 5kvc A:3-254 [327948]
    Other proteins in same PDB: d5kvca2, d5kvcb2
    automated match to d3zn2a_
    complexed with cl, edo, imd, na; mutant

Details for d5kvca1

PDB Entry: 5kvc (more details), 1.5 Å

PDB Description: thermostable mutant of halohydrin dehalogenase (hhec)
PDB Compounds: (A:) halohydrin dehalogenase

SCOPe Domain Sequences for d5kvca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kvca1 c.2.1.0 (A:3-254) automated matches {Rhizobium radiobacter [TaxId: 358]}
taivtnvkhfggmgsalrlseaghtvlchdesfkqkkeleafaetypqlkpmseqepael
iravtraygqvdvlvsndifapefrpidkytvedyrgavealqirpfalvnavasqmkkr
ksghiifitsatpfgpwkelstytsaragantlanvlskelgeynipvfaigpnylhsed
spyfypttpwktnpkhiahvkkvtalqrlgtqkelgelvaflasgscdyltgqifwlagg
fpmierwpgmpe

SCOPe Domain Coordinates for d5kvca1:

Click to download the PDB-style file with coordinates for d5kvca1.
(The format of our PDB-style files is described here.)

Timeline for d5kvca1:

  • d5kvca1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5kvca2