Lineage for d5hcoa_ (5hco A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060798Protein Endothiapepsin [50647] (1 species)
  7. 2060799Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (504 PDB entries)
  8. 2284644Domain d5hcoa_: 5hco A: [327945]
    automated match to d1oewa_
    complexed with 601, act, dms, gol, pg4

Details for d5hcoa_

PDB Entry: 5hco (more details), 1.17 Å

PDB Description: endothiapepsin in complex with hydrazide
PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d5hcoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hcoa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d5hcoa_:

Click to download the PDB-style file with coordinates for d5hcoa_.
(The format of our PDB-style files is described here.)

Timeline for d5hcoa_:

  • d5hcoa_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12