SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hcoa_ (5hco A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060798Protein Endothiapepsin [50647] (1 species)
  7. 2060799Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (500 PDB entries)
  8. 2284644Domain d5hcoa_: 5hco A: [327945]
    automated match to d1oewa_
    complexed with 601, act, dms, gol, pg4

Details for d5hcoa_

PDB Entry: 5hco (more details), 1.17 Å

PDB Description: endothiapepsin in complex with hydrazide
PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d5hcoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hcoa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d5hcoa_:

Click to download the PDB-style file with coordinates for d5hcoa_.
(The format of our PDB-style files is described here.)

Timeline for d5hcoa_:

  • d5hcoa_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12