Lineage for d5iy5a_ (5iy5 A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3026966Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 3026967Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 3026968Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 3027023Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species)
  7. 3027024Species Cow (Bos taurus) [TaxId:9913] [81432] (40 PDB entries)
  8. 3027077Domain d5iy5a_: 5iy5 A: [327939]
    Other proteins in same PDB: d5iy51_, d5iy52_, d5iy5b1, d5iy5b2, d5iy5c_, d5iy5d_, d5iy5e_, d5iy5f_, d5iy5g_, d5iy5h_, d5iy5i_, d5iy5j_, d5iy5k_, d5iy5l_, d5iy5m_, d5iy5o1, d5iy5o2, d5iy5p_, d5iy5q_, d5iy5r_, d5iy5s_, d5iy5t_, d5iy5u_, d5iy5v_, d5iy5w_, d5iy5x_, d5iy5y_, d5iy5z_
    automated match to d1v54a_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, hec, mg, na, pek, per, pgv, psc, tgl, unl, zn

Details for d5iy5a_

PDB Entry: 5iy5 (more details), 2 Å

PDB Description: electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d5iy5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iy5a_ f.24.1.1 (A:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

SCOPe Domain Coordinates for d5iy5a_:

Click to download the PDB-style file with coordinates for d5iy5a_.
(The format of our PDB-style files is described here.)

Timeline for d5iy5a_: