Lineage for d5iy5h_ (5iy5 H:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000510Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2000511Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 2000512Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2000513Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 2000514Species Cow (Bos taurus) [TaxId:9913] [47697] (19 PDB entries)
  8. 2000537Domain d5iy5h_: 5iy5 H: [327938]
    Other proteins in same PDB: d5iy51_, d5iy52_, d5iy5a_, d5iy5b1, d5iy5b2, d5iy5c_, d5iy5d_, d5iy5e_, d5iy5f_, d5iy5g_, d5iy5i_, d5iy5j_, d5iy5k_, d5iy5l_, d5iy5m_, d5iy5n_, d5iy5o1, d5iy5o2, d5iy5p_, d5iy5q_, d5iy5r_, d5iy5s_, d5iy5t_, d5iy5v_, d5iy5w_, d5iy5x_, d5iy5y_, d5iy5z_
    automated match to d1v54h_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, hem, mg, na, pek, per, pgv, psc, tgl, unl, zn

Details for d5iy5h_

PDB Entry: 5iy5 (more details), 2 Å

PDB Description: electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
PDB Compounds: (H:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d5iy5h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iy5h_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d5iy5h_:

Click to download the PDB-style file with coordinates for d5iy5h_.
(The format of our PDB-style files is described here.)

Timeline for d5iy5h_: