SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hdnc1 (5hdn C:15-118)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982720Family a.4.5.22: Heat-shock transcription factor [46873] (2 protein domains)
    automatically mapped to Pfam PF00447
  6. 1982740Protein automated matches [254598] (1 species)
    not a true protein
  7. 1982741Species Human (Homo sapiens) [TaxId:9606] [255429] (3 PDB entries)
  8. 2284634Domain d5hdnc1: 5hdn C:15-118 [327935]
    Other proteins in same PDB: d5hdna2, d5hdnb2, d5hdnc2, d5hdnd2
    automated match to d1hksa_
    protein/DNA complex; complexed with cit, na

Details for d5hdnc1

PDB Entry: 5hdn (more details), 1.68 Å

PDB Description: crystal structure of heat shock factor1-dbd complex with ds-dna and ttt
PDB Compounds: (C:) Heat shock factor protein 1

SCOPe Domain Sequences for d5hdnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hdnc1 a.4.5.22 (C:15-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasfvrqln
mygfrkvvhieqgglvkperddtefqhpcflrgqeqllenikrk

SCOPe Domain Coordinates for d5hdnc1:

Click to download the PDB-style file with coordinates for d5hdnc1.
(The format of our PDB-style files is described here.)

Timeline for d5hdnc1:

  • d5hdnc1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12