SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fvgb1 (5fvg B:1-223)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2165335Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2165336Protein automated matches [190526] (21 species)
    not a true protein
  7. 2165512Species Lobophyllia hemprichii [TaxId:46758] [187486] (17 PDB entries)
  8. 2284632Domain d5fvgb1: 5fvg B:1-223 [327933]
    Other proteins in same PDB: d5fvgb2, d5fvgc2
    automated match to d2vvjc_
    complexed with so4

Details for d5fvgb1

PDB Entry: 5fvg (more details), 1.9 Å

PDB Description: structure of irisfp at 100 k.
PDB Compounds: (B:) Green to red photoconvertible GFP-like protein EosFP

SCOPe Domain Sequences for d5fvgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fvgb1 d.22.1.0 (B:1-223) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn

SCOPe Domain Coordinates for d5fvgb1:

Click to download the PDB-style file with coordinates for d5fvgb1.
(The format of our PDB-style files is described here.)

Timeline for d5fvgb1:

  • d5fvgb1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12