SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jycd_ (5jyc D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (79 species)
    not a true protein
  7. 2136524Species Pseudomonas aeruginosa [TaxId:208963] [255906] (18 PDB entries)
  8. 2284631Domain d5jycd_: 5jyc D: [327932]
    automated match to d4dnod_
    complexed with eet; mutant

Details for d5jycd_

PDB Entry: 5jyc (more details), 2 Å

PDB Description: crystal structure of the e153q mutant of the cftr inhibitory factor cif containing the adducted 14,15-eet hydrolysis intermediate
PDB Compounds: (D:) CFTR inhibitory factor

SCOPe Domain Sequences for d5jycd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jycd_ c.69.1.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}
aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhh

SCOPe Domain Coordinates for d5jycd_:

Click to download the PDB-style file with coordinates for d5jycd_.
(The format of our PDB-style files is described here.)

Timeline for d5jycd_:

  • d5jycd_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12