SCOPe 2.08: Domain d5iy5z_: 5iy5 Z:

Lineage for d5iy5z_ (5iy5 Z:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family)
   automatically mapped to Pfam PF02285

5. Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81429] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81428] (33 PDB entries)

8. Domain d5iy5z_: 5iy5 Z: [327930]
   Other proteins in same PDB: d5iy51_, d5iy52_, d5iy5a_, d5iy5b1, d5iy5b2, d5iy5c_, d5iy5d_, d5iy5e_, d5iy5f_, d5iy5g_, d5iy5h_, d5iy5i_, d5iy5j_, d5iy5k_, d5iy5l_, d5iy5n_, d5iy5o1, d5iy5o2, d5iy5p_, d5iy5q_, d5iy5r_, d5iy5s_, d5iy5t_, d5iy5u_, d5iy5v_, d5iy5w_, d5iy5x_, d5iy5y_
   automated match to d1v54m_
   complexed with cdl, chd, cu, cua, dmu, edo, hea, hec, mg, na, pek, per, pgv, psc, tgl, unl, zn

Details for d5iy5z_

PDB Entry: 5iy5, 2 Å

PDB Description: electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution

PDB Compounds: (Z:) cytochrome c oxidase subunit 8b, mitochondrial

SCOPe Domain Sequences for d5iy5z_:

Sequence; same for both SEQRES and ATOM records:

>d5iy5z_ f.23.7.1 (Z:) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

Timeline for d5iy5z_:

• d5iy5z_ first appeared in SCOPe 2.06
  
• d5iy5z_ appears in SCOPe 2.07