SCOPe 2.06: Domain d5hdkb1: 5hdk B:7-110

Lineage for d5hdkb1 (5hdk B:7-110)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186924] (16 PDB entries)

8. Domain d5hdkb1: 5hdk B:7-110 [327928]
   Other proteins in same PDB: d5hdka2, d5hdkb2, d5hdkc2, d5hdkd2
   automated match to d1hksa_
   complexed with cl, k, na

Details for d5hdkb1

PDB Entry: 5hdk, 1.32 Å

PDB Description: crystal structure of heat shock factor 2-dbd

PDB Compounds: (B:) Heat shock factor protein 2

SCOPe Domain Sequences for d5hdkb1:

Sequence, based on SEQRES records:

>d5hdkb1 a.4.5.0 (B:7-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmasfvrqln
mygfrkvvhidsgivkqerdgpvefqhpyfkqgqddllenikrk

Sequence, based on observed residues (ATOM records):

>d5hdkb1 a.4.5.0 (B:7-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmasfvrqln
mygfrkvvhigpvefqhpyfkqgqddllenikrk

Timeline for d5hdkb1:

• d5hdkb1 is new in SCOPe 2.06-stable
  
• d5hdkb1 appears in SCOPe 2.07
  
• d5hdkb1 appears in the current release, SCOPe 2.08