SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jdvb_ (5jdv B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2067966Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2067967Protein Carbonic anhydrase [51071] (10 species)
  7. 2068005Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (634 PDB entries)
    Uniprot P00918
  8. 2284624Domain d5jdvb_: 5jdv B: [327925]
    automated match to d2foua_
    complexed with evf, zn

Details for d5jdvb_

PDB Entry: 5jdv (more details), 1.34 Å

PDB Description: human carbonic anhydrase ii (f131w) complexed with benzo[d]thiazole-2- sulfonamide
PDB Compounds: (B:) Carbonic anhydrase 2

SCOPe Domain Sequences for d5jdvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jdvb_ b.74.1.1 (B:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdwgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

SCOPe Domain Coordinates for d5jdvb_:

Click to download the PDB-style file with coordinates for d5jdvb_.
(The format of our PDB-style files is described here.)

Timeline for d5jdvb_:

  • d5jdvb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12