Lineage for d5jehb1 (5jeh B:3-260)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2067966Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2067967Protein Carbonic anhydrase [51071] (10 species)
  7. 2068005Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (675 PDB entries)
    Uniprot P00918
  8. 2284622Domain d5jehb1: 5jeh B:3-260 [327923]
    Other proteins in same PDB: d5jehb2
    automated match to d2foua_
    complexed with evf, zn

Details for d5jehb1

PDB Entry: 5jeh (more details), 1.13 Å

PDB Description: human carbonic anhydrase ii (l198a) complexed with benzo[d]thiazole-2- sulfonamide
PDB Compounds: (B:) Carbonic anhydrase 2

SCOPe Domain Sequences for d5jehb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jehb1 b.74.1.1 (B:3-260) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgsattppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

SCOPe Domain Coordinates for d5jehb1:

Click to download the PDB-style file with coordinates for d5jehb1.
(The format of our PDB-style files is described here.)

Timeline for d5jehb1:

  • d5jehb1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5jehb2