SCOPe 2.06: Domain d5h3hb_: 5h3h B:

Lineage for d5h3hb_ (5h3h B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Exiguobacterium antarcticum [TaxId:1087448] [327921] (1 PDB entry)

8. Domain d5h3hb_: 5h3h B: [327922]
   automated match to d1zoia_
   complexed with f50

Details for d5h3hb_

PDB Entry: 5h3h, 1.9 Å

PDB Description: esterase (eaest) from exiguobacterium antarcticum

PDB Compounds: (B:) Abhydrolase domain-containing protein

SCOPe Domain Sequences for d5h3hb_:

Sequence; same for both SEQRES and ATOM records:

>d5h3hb_ c.69.1.0 (B:) automated matches {Exiguobacterium antarcticum [TaxId: 1087448]}
mgtfiqavdgtkiyvedigsgqpvvmlhgwpannnmfeyqknrlleegyryigvdyrgyg
ksdapatgydyttmasdineviqqlkltnvtllgfsmgggialkyllnhgesnvsklila
gaaapvftqrdgypygmtkdevdaliedtkqdrpsmlkgfgeiffakehpeplqqwfhnl
svdasshgtiqsaialrdedlrdglpkitvdtlimhgkkdqvcpfefaevmheniagsrl
evfeesghgmflderekftetlvsyvkss

Timeline for d5h3hb_:

• d5h3hb_ is new in SCOPe 2.06-stable
  
• d5h3hb_ appears in SCOPe 2.07
  
• d5h3hb_ appears in the current release, SCOPe 2.08