SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h3hb_ (5h3h B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (82 species)
    not a true protein
  7. 2284620Species Exiguobacterium antarcticum [TaxId:1087448] [327921] (1 PDB entry)
  8. 2284621Domain d5h3hb_: 5h3h B: [327922]
    automated match to d1zoia_
    complexed with f50

Details for d5h3hb_

PDB Entry: 5h3h (more details), 1.9 Å

PDB Description: esterase (eaest) from exiguobacterium antarcticum
PDB Compounds: (B:) Abhydrolase domain-containing protein

SCOPe Domain Sequences for d5h3hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h3hb_ c.69.1.0 (B:) automated matches {Exiguobacterium antarcticum [TaxId: 1087448]}
mgtfiqavdgtkiyvedigsgqpvvmlhgwpannnmfeyqknrlleegyryigvdyrgyg
ksdapatgydyttmasdineviqqlkltnvtllgfsmgggialkyllnhgesnvsklila
gaaapvftqrdgypygmtkdevdaliedtkqdrpsmlkgfgeiffakehpeplqqwfhnl
svdasshgtiqsaialrdedlrdglpkitvdtlimhgkkdqvcpfefaevmheniagsrl
evfeesghgmflderekftetlvsyvkss

SCOPe Domain Coordinates for d5h3hb_:

Click to download the PDB-style file with coordinates for d5h3hb_.
(The format of our PDB-style files is described here.)

Timeline for d5h3hb_:

  • d5h3hb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12