SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h85a1 (5h85 A:1081-1197)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992367Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1992368Family a.29.2.1: Bromodomain [47371] (5 protein domains)
  6. 1992403Protein automated matches [190366] (1 species)
    not a true protein
  7. 1992404Species Human (Homo sapiens) [TaxId:9606] [187201] (46 PDB entries)
  8. 2284615Domain d5h85a1: 5h85 A:1081-1197 [327916]
    Other proteins in same PDB: d5h85a2
    automated match to d4nyva_
    complexed with 5xs

Details for d5h85a1

PDB Entry: 5h85 (more details), 1.7 Å

PDB Description: crystal structure of the bromodomain of human crebbp in complex with uo37d
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d5h85a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h85a1 a.29.2.1 (A:1081-1197) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikr
kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

SCOPe Domain Coordinates for d5h85a1:

Click to download the PDB-style file with coordinates for d5h85a1.
(The format of our PDB-style files is described here.)

Timeline for d5h85a1:

  • d5h85a1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5h85a2