Lineage for d5hfle1 (5hfl E:546-653)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2592473Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 2592474Family h.3.2.1: Virus ectodomain [58070] (9 protein domains)
  6. 2592520Protein Retrovius gp41 protease-resistant core [58071] (4 species)
    coiled coil; biological unit: trimer
  7. 2592521Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (26 PDB entries)
  8. 2592551Domain d5hfle1: 5hfl E:546-653 [327913]
    Other proteins in same PDB: d5hfla2, d5hflb2, d5hflc2, d5hfld2, d5hfle2, d5hflf2
    automated match to d1f23b_

Details for d5hfle1

PDB Entry: 5hfl (more details), 2.29 Å

PDB Description: gp41-targeting hiv-1 fusion inhibitors with helical ile-asp-leu tail
PDB Compounds: (E:) Envelope glycoprotein,gp41 CHR region

SCOPe Domain Sequences for d5hfle1:

Sequence, based on SEQRES records: (download)

>d5hfle1 h.3.2.1 (E:546-653) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
sgivqqqnnllraieaqqhllqltvwgikqlqarilsggrggweewdkkieeytkkieel
ikksqnqq

Sequence, based on observed residues (ATOM records): (download)

>d5hfle1 h.3.2.1 (E:546-653) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
sgivqqqnnllraieaqqhllqltvwgikqlqariggweewdkkieeytkkieelikksq
nqq

SCOPe Domain Coordinates for d5hfle1:

Click to download the PDB-style file with coordinates for d5hfle1.
(The format of our PDB-style files is described here.)

Timeline for d5hfle1: