Lineage for d5hdnd1 (5hdn D:15-118)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982720Family a.4.5.22: Heat-shock transcription factor [46873] (2 protein domains)
    automatically mapped to Pfam PF00447
  6. 1982740Protein automated matches [254598] (1 species)
    not a true protein
  7. 1982741Species Human (Homo sapiens) [TaxId:9606] [255429] (3 PDB entries)
  8. 2284610Domain d5hdnd1: 5hdn D:15-118 [327911]
    Other proteins in same PDB: d5hdna2, d5hdnb2, d5hdnc2, d5hdnd2
    automated match to d1hksa_
    protein/DNA complex; complexed with cit, na

Details for d5hdnd1

PDB Entry: 5hdn (more details), 1.68 Å

PDB Description: crystal structure of heat shock factor1-dbd complex with ds-dna and ttt
PDB Compounds: (D:) Heat shock factor protein 1

SCOPe Domain Sequences for d5hdnd1:

Sequence, based on SEQRES records: (download)

>d5hdnd1 a.4.5.22 (D:15-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasfvrqln
mygfrkvvhieqgglvkperddtefqhpcflrgqeqllenikrk

Sequence, based on observed residues (ATOM records): (download)

>d5hdnd1 a.4.5.22 (D:15-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasfvrqln
mygfrkvvhidtefqhpcflrgqeqllenikrk

SCOPe Domain Coordinates for d5hdnd1:

Click to download the PDB-style file with coordinates for d5hdnd1.
(The format of our PDB-style files is described here.)

Timeline for d5hdnd1:

  • d5hdnd1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12