SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hdkd1 (5hdk D:7-111)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (64 species)
    not a true protein
  7. 1983803Species Human (Homo sapiens) [TaxId:9606] [186924] (15 PDB entries)
  8. 2284608Domain d5hdkd1: 5hdk D:7-111 [327909]
    Other proteins in same PDB: d5hdka2, d5hdkb2, d5hdkc2, d5hdkd2
    automated match to d1hksa_
    complexed with cl, k, na

Details for d5hdkd1

PDB Entry: 5hdk (more details), 1.32 Å

PDB Description: crystal structure of heat shock factor 2-dbd
PDB Compounds: (D:) Heat shock factor protein 2

SCOPe Domain Sequences for d5hdkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hdkd1 a.4.5.0 (D:7-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmasfvrqln
mygfrkvvhidsgivkqerdgpvefqhpyfkqgqddllenikrkv

SCOPe Domain Coordinates for d5hdkd1:

Click to download the PDB-style file with coordinates for d5hdkd1.
(The format of our PDB-style files is described here.)

Timeline for d5hdkd1:

  • d5hdkd1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12