Lineage for d5h1za_ (5h1z A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (61 species)
    not a true protein
  7. 2284606Species Sphingomonas sp. [TaxId:1112214] [327907] (1 PDB entry)
  8. 2284607Domain d5h1za_: 5h1z A: [327908]
    automated match to d3ivya_
    complexed with d12, hem

Details for d5h1za_

PDB Entry: 5h1z (more details), 3.1 Å

PDB Description: cyp153d17 from sphingomonas sp. pamc 26605
PDB Compounds: (A:) putative CYP alkane hydroxylase CYP153D17

SCOPe Domain Sequences for d5h1za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h1za_ a.104.1.0 (A:) automated matches {Sphingomonas sp. [TaxId: 1112214]}
vidrfdvsrpelyrddlwqapfrelratapvhrvehsdfgpywsvssykpiitveslpdl
yssaggitladfiennptdvrmpmfiamdrpkhtgqrrtvapaftpsemvrmsdnirmrt
aevldslewntpfdwvdtvsvelttqmlailfdfpweerrkltfwsdwagdielvkneel
rlerlrhmyecggyfqnlwnakigkpptpdlismmihsdamaemdqmeflgnlillivgg
ndttrntmsavaygldlfpdqrakleadpsmipntvqeiirwqtplahmrrtatvdsele
gqqikagdklalwyisanrdesvfenadriivdrpnarrhlafghgihrcvgarlaelqi
avlleemakrrmrvnvlgepervaacfvhgyrklpveisr

SCOPe Domain Coordinates for d5h1za_:

Click to download the PDB-style file with coordinates for d5h1za_.
(The format of our PDB-style files is described here.)

Timeline for d5h1za_:

  • d5h1za_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12