SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h1za_ (5h1z A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (58 species)
    not a true protein
  7. 2284606Species Sphingomonas sp. [TaxId:1112214] [327907] (1 PDB entry)
  8. 2284607Domain d5h1za_: 5h1z A: [327908]
    automated match to d3ivya_
    complexed with d12, hem

Details for d5h1za_

PDB Entry: 5h1z (more details), 3.1 Å

PDB Description: cyp153d17 from sphingomonas sp. pamc 26605
PDB Compounds: (A:) putative CYP alkane hydroxylase CYP153D17

SCOPe Domain Sequences for d5h1za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h1za_ a.104.1.0 (A:) automated matches {Sphingomonas sp. [TaxId: 1112214]}
vidrfdvsrpelyrddlwqapfrelratapvhrvehsdfgpywsvssykpiitveslpdl
yssaggitladfiennptdvrmpmfiamdrpkhtgqrrtvapaftpsemvrmsdnirmrt
aevldslewntpfdwvdtvsvelttqmlailfdfpweerrkltfwsdwagdielvkneel
rlerlrhmyecggyfqnlwnakigkpptpdlismmihsdamaemdqmeflgnlillivgg
ndttrntmsavaygldlfpdqrakleadpsmipntvqeiirwqtplahmrrtatvdsele
gqqikagdklalwyisanrdesvfenadriivdrpnarrhlafghgihrcvgarlaelqi
avlleemakrrmrvnvlgepervaacfvhgyrklpveisr

SCOPe Domain Coordinates for d5h1za_:

Click to download the PDB-style file with coordinates for d5h1za_.
(The format of our PDB-style files is described here.)

Timeline for d5h1za_:

  • d5h1za_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12