Lineage for d5ezyf2 (5ezy F:77-378)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2194861Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2194862Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2195211Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 protein domains)
    Pfam PF03133; PubMed 22020298
  6. 2195212Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (2 species)
  7. 2195213Species Chicken (Gallus gallus) [TaxId:9031] [311385] (29 PDB entries)
  8. 2284599Domain d5ezyf2: 5ezy F:77-378 [327900]
    Other proteins in same PDB: d5ezya1, d5ezya2, d5ezyb1, d5ezyb2, d5ezyc1, d5ezyc2, d5ezyd1, d5ezyd2, d5ezye_, d5ezyf1, d5ezyf3
    automated match to d3tiia2
    complexed with acp, ca, gdp, gtp, mes, mg, taj

Details for d5ezyf2

PDB Entry: 5ezy (more details), 2.05 Å

PDB Description: crystal structure of t2r-ttl-taccalonolide aj complex
PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d5ezyf2:

Sequence, based on SEQRES records: (download)

>d5ezyf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records): (download)

>d5ezyf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptderevflaaynrrregregnvwiakssgiliss
easelldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrts
sepynsanfqdktchltnhciqkeysknygryeegnemffeefnqylmdalnttlensil
lqikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklya
elcqgivdvaissvfplatsifikl

SCOPe Domain Coordinates for d5ezyf2:

Click to download the PDB-style file with coordinates for d5ezyf2.
(The format of our PDB-style files is described here.)

Timeline for d5ezyf2:

  • d5ezyf2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12