Lineage for d5ezyf1 (5ezy F:1-76)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2106806Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2106807Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2107090Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2107091Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2107092Species Chicken (Gallus gallus) [TaxId:9031] [311384] (35 PDB entries)
  8. 2284598Domain d5ezyf1: 5ezy F:1-76 [327899]
    Other proteins in same PDB: d5ezya1, d5ezya2, d5ezyb1, d5ezyb2, d5ezyc1, d5ezyc2, d5ezyd1, d5ezyd2, d5ezye_, d5ezyf2, d5ezyf3
    automated match to d3tiia1
    complexed with acp, ca, gdp, gtp, mes, mg, taj

Details for d5ezyf1

PDB Entry: 5ezy (more details), 2.05 Å

PDB Description: crystal structure of t2r-ttl-taccalonolide aj complex
PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d5ezyf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ezyf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d5ezyf1:

Click to download the PDB-style file with coordinates for d5ezyf1.
(The format of our PDB-style files is described here.)

Timeline for d5ezyf1:

  • d5ezyf1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12