SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ezyb1 (5ezy B:2-245)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107739Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2107740Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2107741Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2107851Protein automated matches [226837] (6 species)
    not a true protein
  7. 2107855Species Cow (Bos taurus) [TaxId:9913] [226564] (30 PDB entries)
  8. 2284592Domain d5ezyb1: 5ezy B:2-245 [327893]
    Other proteins in same PDB: d5ezya2, d5ezyb2, d5ezyc2, d5ezyd2, d5ezye_, d5ezyf1, d5ezyf2, d5ezyf3
    automated match to d4drxb1
    complexed with acp, ca, gdp, gtp, mes, mg, taj

Details for d5ezyb1

PDB Entry: 5ezy (more details), 2.05 Å

PDB Description: crystal structure of t2r-ttl-taccalonolide aj complex
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5ezyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ezyb1 c.32.1.1 (B:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

SCOPe Domain Coordinates for d5ezyb1:

Click to download the PDB-style file with coordinates for d5ezyb1.
(The format of our PDB-style files is described here.)

Timeline for d5ezyb1:

  • d5ezyb1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12