Lineage for d1acvb2 (1acv B:1-64,B:129-188)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 315307Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 315308Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 315439Family c.47.1.4: Disulphide-bond formation facilitator (DSBA) [52858] (1 protein)
  6. 315440Protein Disulphide-bond formation facilitator (DSBA) [52859] (2 species)
    common fold is interrupted by a small all-alpha domain
  7. 315441Species Escherichia coli [TaxId:562] [52860] (12 PDB entries)
  8. 315452Domain d1acvb2: 1acv B:1-64,B:129-188 [32789]
    Other proteins in same PDB: d1acva1, d1acvb1
    mutant

Details for d1acvb2

PDB Entry: 1acv (more details), 1.9 Å

PDB Description: dsba mutant h32s

SCOP Domain Sequences for d1acvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1acvb2 c.47.1.4 (B:1-64,B:129-188) Disulphide-bond formation facilitator (DSBA) {Escherichia coli}
aqyedgkqyttlekpvagapqvleffsffcpscyqfeevlhisdnvkkklpegvkmtkyh
vnfmXfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyadtvk
ylsek

SCOP Domain Coordinates for d1acvb2:

Click to download the PDB-style file with coordinates for d1acvb2.
(The format of our PDB-style files is described here.)

Timeline for d1acvb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1acvb1