Lineage for d5hatl1 (5hat L:1-138)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2175267Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2175463Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2175464Protein automated matches [226983] (18 species)
    not a true protein
  7. 2284487Species Rhodopseudomonas palustris [TaxId:1076] [327788] (7 PDB entries)
  8. 2284584Domain d5hatl1: 5hat L:1-138 [327885]
    Other proteins in same PDB: d5hata2, d5hatd2, d5hatg2, d5hatj2, d5hatl2
    automated match to d4lf2a1
    complexed with cap, mg; mutant

Details for d5hatl1

PDB Entry: 5hat (more details), 2 Å

PDB Description: structure function studies of r. palustris rubisco (s59f/m331a mutant; cabp-bound)
PDB Compounds: (L:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hatl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hatl1 d.58.9.0 (L:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevft
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

SCOPe Domain Coordinates for d5hatl1:

Click to download the PDB-style file with coordinates for d5hatl1.
(The format of our PDB-style files is described here.)

Timeline for d5hatl1:

  • d5hatl1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-05