SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hanj1 (5han J:1-138)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2175267Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2175463Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2175464Protein automated matches [226983] (18 species)
    not a true protein
  7. 2284487Species Rhodopseudomonas palustris [TaxId:1076] [327788] (7 PDB entries)
  8. 2284580Domain d5hanj1: 5han J:1-138 [327881]
    Other proteins in same PDB: d5hanc2, d5hane2, d5hang2, d5hanj2
    automated match to d4lf2a1
    complexed with cap, mg; mutant

Details for d5hanj1

PDB Entry: 5han (more details), 2.04 Å

PDB Description: structure function studies of r. palustris rubisco (s59f mutant; cabp- bound)
PDB Compounds: (J:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hanj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hanj1 d.58.9.0 (J:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevft
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

SCOPe Domain Coordinates for d5hanj1:

Click to download the PDB-style file with coordinates for d5hanj1.
(The format of our PDB-style files is described here.)

Timeline for d5hanj1:

  • d5hanj1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-04