Lineage for d5kyoa_ (5kyo A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2284534Species Sphingobium yanoikuyae [TaxId:13690] [327835] (1 PDB entry)
  8. 2284579Domain d5kyoa_: 5kyo A: [327880]
    automated match to d4dxya_
    complexed with hem

Details for d5kyoa_

PDB Entry: 5kyo (more details), 1.8 Å

PDB Description: crystal structure of cyp101j2
PDB Compounds: (A:) cyp101j2

SCOPe Domain Sequences for d5kyoa_:

Sequence, based on SEQRES records: (download)

>d5kyoa_ a.104.1.0 (A:) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
mterpdnvpadrvfdfdiyrdvpegldfhqswreimrqaphplmwtphngghwvalrsdl
aetvmsdferfsnhtvlvpketageayrliplsldppehrpfrsllnenlgpkplrpieq
vvtdlavsliegfrpkgrcnfthefaeqlpvrifmrivdlpvedlpklkhladqytrpdg
siplddvtkqfreylrpviearrikpgedmisrmingevggrpltdieaeniciqvlvgg
ldtvvnmlgftfshlakdhalrraiaadpsliddalleffrrfpvvssarevlrdqefeg
vllkagdmvmaptvvvamddarnedplefrlgrkarqhstfgkgshtcpgahlarmemkv
vlrewfaripefrieddaplrysngivgsvkpfvlewpv

Sequence, based on observed residues (ATOM records): (download)

>d5kyoa_ a.104.1.0 (A:) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
mterpdnvpadrvfdfdiyrdvpegldfhqswreimrqaphplmwtphngghwvalrsdl
aetvmsdferfsnhtvlvpketageayrliplsldppehrpfrsllnenlgpkplrpieq
vvtdlavsliegfrpkgrcnfthefaeqlpvrifmrivdlpvedlpklkhladqytipld
dvtkqfreylrpviearrikpgedmisrmingevggrpltdieaeniciqvlvggldtvv
nmlgftfshlakdhalrraiaadpsliddalleffrrfpvvssarevlrdqefegvllka
gdmvmaptvvvamddarnedplefrlgrkarqhstfgkgshtcpgahlarmemkvvlrew
faripefrieddaplrysngivgsvkpfvlewpv

SCOPe Domain Coordinates for d5kyoa_:

Click to download the PDB-style file with coordinates for d5kyoa_.
(The format of our PDB-style files is described here.)

Timeline for d5kyoa_:

  • d5kyoa_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-04