SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tc9a1 (5tc9 A:2-432)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043561Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 protein domains)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2043562Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (7 species)
  7. 2284571Species Hypocrea jecorina [TaxId:431241] [327872] (1 PDB entry)
  8. 2284572Domain d5tc9a1: 5tc9 A:2-432 [327873]
    Other proteins in same PDB: d5tc9a2
    automated match to d1q2ba_
    complexed with gd3, nag, no3

Details for d5tc9a1

PDB Entry: 5tc9 (more details), 1.6 Å

PDB Description: wild type trcel7a catalytic domain in a closed state
PDB Compounds: (A:) glucanase

SCOPe Domain Sequences for d5tc9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tc9a1 b.29.1.10 (A:2-432) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Hypocrea jecorina [TaxId: 431241]}
sactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstlc
pdnetcaknccldgaayastygvttsgnslsigfvtqsaqknvgarlylmasdttyqeft
llgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdlk
fingqanvegwepssnnantgigghgsccsemdiweansisealtphpcttvgqeicegd
gcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgain
ryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggmv
lvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsni
kfgpigstgnp

SCOPe Domain Coordinates for d5tc9a1:

Click to download the PDB-style file with coordinates for d5tc9a1.
(The format of our PDB-style files is described here.)

Timeline for d5tc9a1:

  • d5tc9a1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-04

View in 3D
Domains from same chain:
(mouse over for more information)
d5tc9a2