SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t6sd_ (5t6s D:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2239599Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2239600Protein automated matches [254645] (18 species)
    not a true protein
  7. 2284510Species Influenza a virus [TaxId:1332244] [327811] (1 PDB entry)
  8. 2284570Domain d5t6sd_: 5t6s D: [327871]
    Other proteins in same PDB: d5t6sa_, d5t6sc_, d5t6se_, d5t6sg_, d5t6si_, d5t6sk_
    automated match to d4kdmb_
    complexed with 75u, bma, na, nag

Details for d5t6sd_

PDB Entry: 5t6s (more details), 2.36 Å

PDB Description: crystal structure of the a/shanghai/2/2013 (h7n9) influenza virus hemagglutinin in complex with the antiviral drug arbidol
PDB Compounds: (D:) hemagglutinin HA2

SCOPe Domain Sequences for d5t6sd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t6sd_ h.3.1.0 (D:) automated matches {Influenza a virus [TaxId: 1332244]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri

SCOPe Domain Coordinates for d5t6sd_:

Click to download the PDB-style file with coordinates for d5t6sd_.
(The format of our PDB-style files is described here.)

Timeline for d5t6sd_:

  • d5t6sd_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-04