Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
Protein automated matches [254645] (42 species) not a true protein |
Species Influenza A virus [TaxId:1332244] [327811] (5 PDB entries) |
Domain d5t6sd_: 5t6s D: [327871] Other proteins in same PDB: d5t6sa_, d5t6sc_, d5t6se_, d5t6sg_, d5t6si_, d5t6sk_ automated match to d4kdmb_ complexed with 75u, na, nag |
PDB Entry: 5t6s (more details), 2.36 Å
SCOPe Domain Sequences for d5t6sd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t6sd_ h.3.1.0 (D:) automated matches {Influenza A virus [TaxId: 1332244]} glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri
Timeline for d5t6sd_: