SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t7ua_ (5t7u A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044115Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2044116Protein automated matches [190437] (51 species)
    not a true protein
  7. 2044265Species Human (Homo sapiens) [TaxId:9606] [187655] (70 PDB entries)
  8. 2284567Domain d5t7ua_: 5t7u A: [327868]
    automated match to d3apba_
    complexed with cl, gol, na

Details for d5t7ua_

PDB Entry: 5t7u (more details), 1.58 Å

PDB Description: crystal structure of galectin-8n in complex with glycerol
PDB Compounds: (A:) Galectin-8

SCOPe Domain Sequences for d5t7ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t7ua_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpradvafhfn
prfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtllyg
hrigpekidtlgiygkvnihsigfsfs

SCOPe Domain Coordinates for d5t7ua_:

Click to download the PDB-style file with coordinates for d5t7ua_.
(The format of our PDB-style files is described here.)

Timeline for d5t7ua_:

  • d5t7ua_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-04