Lineage for d5kyof_ (5kyo F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (68 species)
    not a true protein
  7. 2332128Species Sphingobium yanoikuyae [TaxId:13690] [327835] (1 PDB entry)
  8. 2332134Domain d5kyof_: 5kyo F: [327867]
    automated match to d4dxya_
    complexed with hem

Details for d5kyof_

PDB Entry: 5kyo (more details), 1.8 Å

PDB Description: crystal structure of cyp101j2
PDB Compounds: (F:) cyp101j2

SCOPe Domain Sequences for d5kyof_:

Sequence, based on SEQRES records: (download)

>d5kyof_ a.104.1.0 (F:) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
erpdnvpadrvfdfdiyrdvpegldfhqswreimrqaphplmwtphngghwvalrsdlae
tvmsdferfsnhtvlvpketageayrliplsldppehrpfrsllnenlgpkplrpieqvv
tdlavsliegfrpkgrcnfthefaeqlpvrifmrivdlpvedlpklkhladqytrpdgsi
plddvtkqfreylrpviearrikpgedmisrmingevggrpltdieaeniciqvlvggld
tvvnmlgftfshlakdhalrraiaadpsliddalleffrrfpvvssarevlrdqefegvl
lkagdmvmaptvvvamddarnedplefrlgrkarqhstfgkgshtcpgahlarmemkvvl
rewfaripefrieddaplrysngivgsvkpfvlewpv

Sequence, based on observed residues (ATOM records): (download)

>d5kyof_ a.104.1.0 (F:) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
erpdnvpadrvfdfdiyrdvpegldfhqswreplmwtphngghwvalrsdlaetvmsdfe
rfsnhtvlvpketageayrliplsldppehrpfrsllnenlgpkplrpieqvvtdlavsl
iegfrpkgrcnfthefaeqlpvrifmrivdlpvedlpklkhladqytplddvtkqfreyl
rpviearrikpgedmisrmingevggpltdieaeniciqvlvggldtvvnmlgftfshla
kdhalrraiaadpsliddalleffrrfpvvssarevlrdqefegvllkagdmvmaptvvv
amddarnedplefrlgrkarqhstfgkgshtcpgahlarmemkvvlrewfaripefried
daplrysngivgsvkpfvlewpv

SCOPe Domain Coordinates for d5kyof_:

Click to download the PDB-style file with coordinates for d5kyof_.
(The format of our PDB-style files is described here.)

Timeline for d5kyof_: