SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hbda1 (5hbd A:2-238)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2164733Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2165015Protein automated matches [190406] (17 species)
    not a true protein
  7. 2165183Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (48 PDB entries)
  8. 2284564Domain d5hbda1: 5hbd A:2-238 [327865]
    Other proteins in same PDB: d5hbda2
    automated match to d3st3a_

Details for d5hbda1

PDB Entry: 5hbd (more details), 1.65 Å

PDB Description: filamentous assembly of green fluorescent protein supported by a c- terminal fusion of 18-residues, viewed in space group c2
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d5hbda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hbda1 d.22.1.1 (A:2-238) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfxlqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
elkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyq
qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk

SCOPe Domain Coordinates for d5hbda1:

Click to download the PDB-style file with coordinates for d5hbda1.
(The format of our PDB-style files is described here.)

Timeline for d5hbda1:

  • d5hbda1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-04

View in 3D
Domains from same chain:
(mouse over for more information)
d5hbda2