SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h2ub1 (5h2u B:185-446)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (813 PDB entries)
  8. 2284560Domain d5h2ub1: 5h2u B:185-446 [327861]
    Other proteins in same PDB: d5h2ua2, d5h2ua3, d5h2ub2, d5h2ub3, d5h2uc2, d5h2uc3, d5h2ud2, d5h2ud3
    automated match to d3clya_
    complexed with 1n1, gol

Details for d5h2ub1

PDB Entry: 5h2u (more details), 2.24 Å

PDB Description: crystal structure of ptk6 kinase domain complexed with dasatinib
PDB Compounds: (B:) Protein-tyrosine kinase 6

SCOPe Domain Sequences for d5h2ub1:

Sequence, based on SEQRES records: (download)

>d5h2ub1 d.144.1.0 (B:185-446) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erpreeftlcrklgsgyfgevfeglwkdrvqvaikvisrdnllhqqmlqseiqamkklrh
khilalyavvsvgdpvyiitelmakgsllellrdsdekvlpvselldiawqvaegmcyle
sqnyihrdlaarnilvgentlckvgdfglarlikedvylshdhnipykwtapealsrghy
stksdvwsfgillhemfsrgqvpypgmsnheaflrvdagyrmpcplecppsvhklmltcw
crdpeqrptfkalrerlssfts

Sequence, based on observed residues (ATOM records): (download)

>d5h2ub1 d.144.1.0 (B:185-446) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erpreeftlcrklgsgyfgevfeglwkdrvqvaikvisrdnllhqqmlqseiqamkklrh
khilalyavvsvgdpvyiitelmakgsllellrsdekvlpvselldiawqvaegmcyles
qnyihrdlaarnilvgentlckvgdfglarlikedvylshdhnipykwtapealsrghys
tksdvwsfgillhemfsrgqvpypgmsnheaflrvdagyrmpcplecppsvhklmltcwc
rdpeqrptfkalrerlssfts

SCOPe Domain Coordinates for d5h2ub1:

Click to download the PDB-style file with coordinates for d5h2ub1.
(The format of our PDB-style files is described here.)

Timeline for d5h2ub1:

  • d5h2ub1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-04