SCOPe 2.08: Domain d5t6ne1: 5t6n E:11-326

Lineage for d5t6ne1 (5t6n E:11-326)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (18 PDB entries)

8. Domain d5t6ne1: 5t6n E:11-326 [327856]
   Other proteins in same PDB: d5t6na2, d5t6nb_, d5t6nc2, d5t6nd_, d5t6ne2, d5t6nf_
   automated match to d4xkga_
   complexed with 75u, gol, nag, so4

Details for d5t6ne1

PDB Entry: 5t6n, 2.54 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin in complex with the antiviral drug arbidol

PDB Compounds: (E:) hemagglutinin HA1

SCOPe Domain Sequences for d5t6ne1:

Sequence; same for both SEQRES and ATOM records:

>d5t6ne1 b.19.1.0 (E:11-326) automated matches {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvpek

Timeline for d5t6ne1:

• d5t6ne1 first appeared in SCOPe 2.06
  
• d5t6ne1 appears in SCOPe 2.07