SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t6nc1 (5t6n C:11-325)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (29 species)
    not a true protein
  7. 2284507Species Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (2 PDB entries)
  8. 2284550Domain d5t6nc1: 5t6n C:11-325 [327851]
    Other proteins in same PDB: d5t6na2, d5t6nb_, d5t6nc2, d5t6nd_, d5t6ne2, d5t6nf_
    automated match to d4xkga_
    complexed with 75u, bma, gol, man, nag, so4

Details for d5t6nc1

PDB Entry: 5t6n (more details), 2.54 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin in complex with the antiviral drug arbidol
PDB Compounds: (C:) hemagglutinin HA1

SCOPe Domain Sequences for d5t6nc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t6nc1 b.19.1.0 (C:11-325) automated matches {Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvpe

SCOPe Domain Coordinates for d5t6nc1:

Click to download the PDB-style file with coordinates for d5t6nc1.
(The format of our PDB-style files is described here.)

Timeline for d5t6nc1:

  • d5t6nc1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-04