Lineage for d1fvkb2 (1fvk B:1-64,B:129-188)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 70901Family c.47.1.4: Disulphide-bond formation facilitator (DSBA) [52858] (1 protein)
  6. 70902Protein Disulphide-bond formation facilitator (DSBA) [52859] (2 species)
  7. 70903Species Escherichia coli [TaxId:562] [52860] (12 PDB entries)
  8. 70905Domain d1fvkb2: 1fvk B:1-64,B:129-188 [32785]
    Other proteins in same PDB: d1fvka1, d1fvkb1

Details for d1fvkb2

PDB Entry: 1fvk (more details), 1.7 Å

PDB Description: the 1.7 angstrom structure of wild type disulfide bond formation protein (dsba)

SCOP Domain Sequences for d1fvkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvkb2 c.47.1.4 (B:1-64,B:129-188) Disulphide-bond formation facilitator (DSBA) {Escherichia coli}
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmXfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyadtvk
ylsek

SCOP Domain Coordinates for d1fvkb2:

Click to download the PDB-style file with coordinates for d1fvkb2.
(The format of our PDB-style files is described here.)

Timeline for d1fvkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fvkb1