Lineage for d5t7ia_ (5t7i A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044115Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2044116Protein automated matches [190437] (53 species)
    not a true protein
  7. 2044265Species Human (Homo sapiens) [TaxId:9606] [187655] (78 PDB entries)
  8. 2284548Domain d5t7ia_: 5t7i A: [327849]
    automated match to d3apba_
    complexed with gal, lat, nag

Details for d5t7ia_

PDB Entry: 5t7i (more details), 2 Å

PDB Description: crystal structure of galectin-8n in complex with lnnt
PDB Compounds: (A:) Galectin-8

SCOPe Domain Sequences for d5t7ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t7ia_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpradvafhfn
prfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtllyg
hrigpekidtlgiygkvnihsigfsfs

SCOPe Domain Coordinates for d5t7ia_:

Click to download the PDB-style file with coordinates for d5t7ia_.
(The format of our PDB-style files is described here.)

Timeline for d5t7ia_:

  • d5t7ia_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-04