SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kyoe_ (5kyo E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (59 species)
    not a true protein
  7. 2284534Species Sphingobium yanoikuyae [TaxId:13690] [327835] (1 PDB entry)
  8. 2284546Domain d5kyoe_: 5kyo E: [327847]
    automated match to d4dxya_
    complexed with hem

Details for d5kyoe_

PDB Entry: 5kyo (more details), 1.8 Å

PDB Description: crystal structure of cyp101j2
PDB Compounds: (E:) cyp101j2

SCOPe Domain Sequences for d5kyoe_:

Sequence, based on SEQRES records: (download)

>d5kyoe_ a.104.1.0 (E:) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
rpdnvpadrvfdfdiyrdvpegldfhqswreimrqaphplmwtphngghwvalrsdlaet
vmsdferfsnhtvlvpketageayrliplsldppehrpfrsllnenlgpkplrpieqvvt
dlavsliegfrpkgrcnfthefaeqlpvrifmrivdlpvedlpklkhladqytrpdgsip
lddvtkqfreylrpviearrikpgedmisrmingevggrpltdieaeniciqvlvggldt
vvnmlgftfshlakdhalrraiaadpsliddalleffrrfpvvssarevlrdqefegvll
kagdmvmaptvvvamddarnedplefrlgrkarqhstfgkgshtcpgahlarmemkvvlr
ewfaripefrieddaplrysngivgsvkpfvlewpv

Sequence, based on observed residues (ATOM records): (download)

>d5kyoe_ a.104.1.0 (E:) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
rpdnvpadrvfdfdiyrdvpldfhqswreimrqaphplmwtphngghwvalrsdlaetvm
sdferfsnhtvlvpketageayrliplsldppehrpfrsllnenlgpkplrpieqvvtdl
avsliegfrpkgrcnfthefaeqlpvrifmrivdlpvedlpklkhladqytrpdgplddv
tkqfreylrpviearrikpgedmisrmingevggltdieaeniciqvlvggldtvvnmlg
ftfshlakdhalrraiaadpsliddalleffrrfpvvssarevlrdqefegvllkagdmv
maptvvvamddarnedplefrlgrkarqhstfgkgshtcpgahlarmemkvvlrewfari
pefrieddaplrysngivgsvkpfvlewpv

SCOPe Domain Coordinates for d5kyoe_:

Click to download the PDB-style file with coordinates for d5kyoe_.
(The format of our PDB-style files is described here.)

Timeline for d5kyoe_:

  • d5kyoe_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-04