SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t6se_ (5t6s E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (28 species)
    not a true protein
  7. 2041025Species Influenza a virus [TaxId:1332244] [228093] (10 PDB entries)
  8. 2284543Domain d5t6se_: 5t6s E: [327844]
    Other proteins in same PDB: d5t6sb_, d5t6sd_, d5t6sf_, d5t6sh_, d5t6sj_, d5t6sl_
    automated match to d4n62a_
    complexed with 75u, bma, na, nag

Details for d5t6se_

PDB Entry: 5t6s (more details), 2.36 Å

PDB Description: crystal structure of the a/shanghai/2/2013 (h7n9) influenza virus hemagglutinin in complex with the antiviral drug arbidol
PDB Compounds: (E:) hemagglutinin HA1

SCOPe Domain Sequences for d5t6se_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t6se_ b.19.1.0 (E:) automated matches {Influenza a virus [TaxId: 1332244]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpe

SCOPe Domain Coordinates for d5t6se_:

Click to download the PDB-style file with coordinates for d5t6se_.
(The format of our PDB-style files is described here.)

Timeline for d5t6se_:

  • d5t6se_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-04