SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gx4a_ (5gx4 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2065620Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) (S)
  5. 2065704Family b.68.6.0: automated matches [277246] (1 protein)
    not a true family
  6. 2065705Protein automated matches [277247] (1 species)
    not a true protein
  7. 2065706Species Firefly (Photinus pyralis) [TaxId:7054] [277248] (9 PDB entries)
  8. 2284542Domain d5gx4a_: 5gx4 A: [327843]
    automated match to d5d9ba_
    complexed with gol, hg, mg, mpd

Details for d5gx4a_

PDB Entry: 5gx4 (more details), 1.6 Å

PDB Description: luciferin-regenerating enzyme collected with serial synchrotron rotational crystallography with accumulated dose of 14 mgy (12th measurement)
PDB Compounds: (A:) Luciferin regenerating enzyme

SCOPe Domain Sequences for d5gx4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gx4a_ b.68.6.0 (A:) automated matches {Firefly (Photinus pyralis) [TaxId: 7054]}
gpvvekiaelgkytvgegphwdhetqtlyfvdtvektfhkyvpsqkkytfckvdklvsfi
iplagspgrfvvslereiailtwdgvsaaptsieaivnvephiknnrlndgkadplgnlw
tgtmaidaglpigpvtgslyhlgadkkvkmhesniaianglawsndlkkmyyidsgkrrv
deydydastlsisnqrplftfekhevpgypdgqtideegnlwvavfqgqriikistqqpe
vlldtvkipdpqvtsvafggpnldelyvtsaglqlddssfdkslvnghvyrvtglgvkgf
agvkvkl

SCOPe Domain Coordinates for d5gx4a_:

Click to download the PDB-style file with coordinates for d5gx4a_.
(The format of our PDB-style files is described here.)

Timeline for d5gx4a_:

  • d5gx4a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-04