Lineage for d5gx5a_ (5gx5 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2808422Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) (S)
  5. 2808510Family b.68.6.0: automated matches [277246] (1 protein)
    not a true family
  6. 2808511Protein automated matches [277247] (1 species)
    not a true protein
  7. 2808512Species Firefly (Photinus pyralis) [TaxId:7054] [277248] (10 PDB entries)
  8. 2808521Domain d5gx5a_: 5gx5 A: [327842]
    automated match to d5d9ba_
    complexed with gol, hg, mg, mpd

Details for d5gx5a_

PDB Entry: 5gx5 (more details), 1.6 Å

PDB Description: luciferin-regenerating enzyme collected with serial synchrotron rotational crystallography with accumulated dose of 26 mgy (23rd measurement)
PDB Compounds: (A:) Luciferin regenerating enzyme

SCOPe Domain Sequences for d5gx5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gx5a_ b.68.6.0 (A:) automated matches {Firefly (Photinus pyralis) [TaxId: 7054]}
gpvvekiaelgkytvgegphwdhetqtlyfvdtvektfhkyvpsqkkytfckvdklvsfi
iplagspgrfvvslereiailtwdgvsaaptsieaivnvephiknnrlndgkadplgnlw
tgtmaidaglpigpvtgslyhlgadkkvkmhesniaianglawsndlkkmyyidsgkrrv
deydydastlsisnqrplftfekhevpgypdgqtideegnlwvavfqgqriikistqqpe
vlldtvkipdpqvtsvafggpnldelyvtsaglqlddssfdkslvnghvyrvtglgvkgf
agvkvkl

SCOPe Domain Coordinates for d5gx5a_:

Click to download the PDB-style file with coordinates for d5gx5a_.
(The format of our PDB-style files is described here.)

Timeline for d5gx5a_: