Class b: All beta proteins [48724] (180 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) |
Family b.68.6.0: automated matches [277246] (1 protein) not a true family |
Protein automated matches [277247] (1 species) not a true protein |
Species Firefly (Photinus pyralis) [TaxId:7054] [277248] (10 PDB entries) |
Domain d5gx5a_: 5gx5 A: [327842] automated match to d5d9ba_ complexed with gol, hg, mg, mpd |
PDB Entry: 5gx5 (more details), 1.6 Å
SCOPe Domain Sequences for d5gx5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gx5a_ b.68.6.0 (A:) automated matches {Firefly (Photinus pyralis) [TaxId: 7054]} gpvvekiaelgkytvgegphwdhetqtlyfvdtvektfhkyvpsqkkytfckvdklvsfi iplagspgrfvvslereiailtwdgvsaaptsieaivnvephiknnrlndgkadplgnlw tgtmaidaglpigpvtgslyhlgadkkvkmhesniaianglawsndlkkmyyidsgkrrv deydydastlsisnqrplftfekhevpgypdgqtideegnlwvavfqgqriikistqqpe vlldtvkipdpqvtsvafggpnldelyvtsaglqlddssfdkslvnghvyrvtglgvkgf agvkvkl
Timeline for d5gx5a_: