Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) |
Family c.47.1.4: Disulphide-bond formation facilitator (DSBA) [52858] (1 protein) |
Protein Disulphide-bond formation facilitator (DSBA) [52859] (2 species) common fold is interrupted by a small all-alpha domain |
Species Escherichia coli [TaxId:562] [52860] (12 PDB entries) |
Domain d1fvka2: 1fvk A:1-64,A:129-188 [32784] Other proteins in same PDB: d1fvka1, d1fvkb1 |
PDB Entry: 1fvk (more details), 1.7 Å
SCOP Domain Sequences for d1fvka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fvka2 c.47.1.4 (A:1-64,A:129-188) Disulphide-bond formation facilitator (DSBA) {Escherichia coli} aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh vnfmXfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyadtvk ylsek
Timeline for d1fvka2: